PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM12G20140.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NAC
Protein Properties Length: 333aa    MW: 36371.3 Da    PI: 8.9766
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM12G20140.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM169.41.1e-52141421128
              NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleev.ikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                      lppGfrFhP+d+el+++yL++kv+gk  ++  +  + +vd++kvePwdLp+ ++ + kewyfFs rd+kyatg+r+nrat sgyWkatgkd+ v
  OGLUM12G20140.1  14 LPPGFRFHPRDDELICDYLAPKVAGKVgFSGRRPpMVDVDLNKVEPWDLPEVASVGGKEWYFFSLRDRKYATGQRTNRATVSGYWKATGKDRVV 107
                      79************************986665656***************8888899***********************************99 PP

              NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                       + +g+lvg++ktLvfy+grapkg+kt+Wvmheyr+
  OGLUM12G20140.1 108 AR-RGALVGMRKTLVFYQGRAPKGRKTEWVMHEYRM 142
                      99.999****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.27E-592167IPR003441NAC domain
PROSITE profilePS5100555.82214167IPR003441NAC domain
PfamPF023652.2E-2715142IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 333 aa     Download sequence    Send to blast
MSMMSFLSMV EAELPPGFRF HPRDDELICD YLAPKVAGKV GFSGRRPPMV DVDLNKVEPW  60
DLPEVASVGG KEWYFFSLRD RKYATGQRTN RATVSGYWKA TGKDRVVARR GALVGMRKTL  120
VFYQGRAPKG RKTEWVMHEY RMEGVHDQQA SSFSSKEDWV LCRVICKRKS GGSATSKSRS  180
LTTTTTTIVH DTSTPTSSPP LPPLMDTTLA QLQASMNTSS SSAIAAVAAL EQVPCFSSFS  240
NSIASNNNNS NSATVNAQQC YLPIVTGSNN NGMSYLDHGL PEFGSFLDTQ SCDKKMLKAV  300
LSQLNSIGGE VLPGLPPPSE MAAAVSSSWM NHF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-511016811169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0714640.0AK071464.1 Oryza sativa Japonica Group cDNA clone:J023097O13, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015620576.10.0PREDICTED: NAC domain-containing protein 21/22 isoform X2
SwissprotQ84TE64e-90NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A0E0BV240.0A0A0E0BV24_9ORYZ; Uncharacterized protein
STRINGLOC_Os12g41680.10.0(Oryza sativa Japonica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100223144
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G56010.21e-79NAC domain containing protein 1